Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3956845..3957539 Replicon chromosome
Accession NZ_CP101197
Organism Escherichia coli strain EC21Z-151

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag NML27_RS19020 Protein ID WP_001263491.1
Coordinates 3956845..3957243 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NML27_RS19025 Protein ID WP_000554755.1
Coordinates 3957246..3957539 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3952674) 3952674..3952754 - 81 NuclAT_10 - -
- (3952674) 3952674..3952754 - 81 NuclAT_10 - -
- (3952674) 3952674..3952754 - 81 NuclAT_10 - -
- (3952674) 3952674..3952754 - 81 NuclAT_10 - -
NML27_RS18990 (3952014) 3952014..3953258 - 1245 WP_000189541.1 esterase FrsA -
NML27_RS18995 (3953350) 3953350..3953808 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NML27_RS19000 (3954069) 3954069..3955526 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NML27_RS19005 (3955583) 3955583..3955935 - 353 Protein_3718 peptide chain release factor H -
NML27_RS19010 (3955931) 3955931..3956137 - 207 Protein_3719 RtcB family protein -
NML27_RS19015 (3956383) 3956383..3956835 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
NML27_RS19020 (3956845) 3956845..3957243 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NML27_RS19025 (3957246) 3957246..3957539 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NML27_RS19030 (3957591) 3957591..3958646 - 1056 WP_001550655.1 DNA polymerase IV -
NML27_RS19035 (3958717) 3958717..3959502 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
NML27_RS19040 (3959474) 3959474..3961186 + 1713 Protein_3725 flagellar biosynthesis protein FlhA -
NML27_RS19045 (3961291) 3961291..3961569 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
NML27_RS19050 (3961562) 3961562..3961918 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3946781..3957539 10758


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T251487 WP_001263491.1 NZ_CP101197:c3957243-3956845 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT251487 WP_000554755.1 NZ_CP101197:c3957539-3957246 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References