Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3956845..3957539 | Replicon | chromosome |
| Accession | NZ_CP101197 | ||
| Organism | Escherichia coli strain EC21Z-151 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | NML27_RS19020 | Protein ID | WP_001263491.1 |
| Coordinates | 3956845..3957243 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | NML27_RS19025 | Protein ID | WP_000554755.1 |
| Coordinates | 3957246..3957539 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3952674) | 3952674..3952754 | - | 81 | NuclAT_10 | - | - |
| - (3952674) | 3952674..3952754 | - | 81 | NuclAT_10 | - | - |
| - (3952674) | 3952674..3952754 | - | 81 | NuclAT_10 | - | - |
| - (3952674) | 3952674..3952754 | - | 81 | NuclAT_10 | - | - |
| NML27_RS18990 (3952014) | 3952014..3953258 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| NML27_RS18995 (3953350) | 3953350..3953808 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| NML27_RS19000 (3954069) | 3954069..3955526 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| NML27_RS19005 (3955583) | 3955583..3955935 | - | 353 | Protein_3718 | peptide chain release factor H | - |
| NML27_RS19010 (3955931) | 3955931..3956137 | - | 207 | Protein_3719 | RtcB family protein | - |
| NML27_RS19015 (3956383) | 3956383..3956835 | - | 453 | WP_019842500.1 | GNAT family N-acetyltransferase | - |
| NML27_RS19020 (3956845) | 3956845..3957243 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NML27_RS19025 (3957246) | 3957246..3957539 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NML27_RS19030 (3957591) | 3957591..3958646 | - | 1056 | WP_001550655.1 | DNA polymerase IV | - |
| NML27_RS19035 (3958717) | 3958717..3959502 | - | 786 | WP_019842510.1 | putative lateral flagellar export/assembly protein LafU | - |
| NML27_RS19040 (3959474) | 3959474..3961186 | + | 1713 | Protein_3725 | flagellar biosynthesis protein FlhA | - |
| NML27_RS19045 (3961291) | 3961291..3961569 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| NML27_RS19050 (3961562) | 3961562..3961918 | + | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3946781..3957539 | 10758 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T251487 WP_001263491.1 NZ_CP101197:c3957243-3956845 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |