Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 759243..759936 | Replicon | chromosome |
Accession | NZ_CP101197 | ||
Organism | Escherichia coli strain EC21Z-151 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | NML27_RS03660 | Protein ID | WP_000415584.1 |
Coordinates | 759243..759539 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | NML27_RS03665 | Protein ID | WP_000650107.1 |
Coordinates | 759541..759936 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML27_RS03625 (754292) | 754292..754606 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
NML27_RS03630 (754637) | 754637..755218 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
NML27_RS03635 (755576) | 755576..755905 | + | 330 | WP_001551659.1 | DUF2645 family protein | - |
NML27_RS03640 (755954) | 755954..757303 | - | 1350 | WP_001551658.1 | quorum sensing histidine kinase QseC | - |
NML27_RS03645 (757300) | 757300..757959 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
NML27_RS03650 (758111) | 758111..758503 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
NML27_RS03655 (758556) | 758556..759038 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
NML27_RS03660 (759243) | 759243..759539 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
NML27_RS03665 (759541) | 759541..759936 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
NML27_RS03670 (760069) | 760069..761676 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
NML27_RS03675 (761814) | 761814..764072 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | rfaE | 686974..764072 | 77098 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T251472 WP_000415584.1 NZ_CP101197:759243-759539 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT251472 WP_000650107.1 NZ_CP101197:759541-759936 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|