Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 6026272..6026935 | Replicon | chromosome |
Accession | NZ_CP101125 | ||
Organism | Pseudomonas nunensis strain In5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A6L5BTX6 |
Locus tag | NK667_RS26505 | Protein ID | WP_054616608.1 |
Coordinates | 6026272..6026637 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A423JKM8 |
Locus tag | NK667_RS26510 | Protein ID | WP_054616609.1 |
Coordinates | 6026630..6026935 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NK667_RS26485 (NK667_26485) | 6021362..6021880 | - | 519 | WP_054616604.1 | GNAT family N-acetyltransferase | - |
NK667_RS26490 (NK667_26490) | 6021898..6023994 | - | 2097 | WP_054616605.1 | biotin/lipoyl-binding protein | - |
NK667_RS26495 (NK667_26495) | 6023995..6025314 | - | 1320 | WP_054616606.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
NK667_RS26500 (NK667_26500) | 6025311..6026093 | - | 783 | WP_054616607.1 | efflux RND transporter periplasmic adaptor subunit | - |
NK667_RS26505 (NK667_26505) | 6026272..6026637 | + | 366 | WP_054616608.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NK667_RS26510 (NK667_26510) | 6026630..6026935 | + | 306 | WP_054616609.1 | XRE family transcriptional regulator | Antitoxin |
NK667_RS26515 (NK667_26515) | 6027040..6027597 | - | 558 | WP_054616610.1 | hypothetical protein | - |
NK667_RS26520 (NK667_26520) | 6027709..6029241 | - | 1533 | WP_054616611.1 | efflux transporter outer membrane subunit | - |
NK667_RS26525 (NK667_26525) | 6029238..6030302 | - | 1065 | WP_054616612.1 | HlyD family secretion protein | - |
NK667_RS26530 (NK667_26530) | 6030329..6031864 | - | 1536 | WP_054616613.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13826.29 Da Isoelectric Point: 5.5128
>T251445 WP_054616608.1 NZ_CP101125:6026272-6026637 [Pseudomonas nunensis]
MNWDIEYTDEFGDWWTDLSESEQSSVAASVKLLGQFGPGLRFPHSSGINGSRHGHLRELRVQHAGRPYRILYAFDPKRCA
LLLIGGDKTGQDRWYEVNVPLADQLYDEHLDTLRKEGHNDG
MNWDIEYTDEFGDWWTDLSESEQSSVAASVKLLGQFGPGLRFPHSSGINGSRHGHLRELRVQHAGRPYRILYAFDPKRCA
LLLIGGDKTGQDRWYEVNVPLADQLYDEHLDTLRKEGHNDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6L5BTX6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A423JKM8 |