Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
| Location | 2410185..2410708 | Replicon | chromosome |
| Accession | NZ_CP101124 | ||
| Organism | Staphylococcus aureus subsp. aureus RN4220 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | X5DYX7 |
| Locus tag | NMK49_RS11880 | Protein ID | WP_000074048.1 |
| Coordinates | 2410185..2410451 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | W8TQT5 |
| Locus tag | NMK49_RS11885 | Protein ID | WP_000587616.1 |
| Coordinates | 2410451..2410708 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK49_RS11860 | 2405492..2406679 | - | 1188 | WP_000026194.1 | MFS transporter | - |
| NMK49_RS11865 | 2407075..2407851 | - | 777 | WP_000072147.1 | iron export ABC transporter permease subunit FetB | - |
| NMK49_RS11870 | 2407844..2408506 | - | 663 | WP_000923520.1 | ATP-binding cassette domain-containing protein | - |
| NMK49_RS11875 | 2408754..2409830 | - | 1077 | WP_001076671.1 | M42 family metallopeptidase | - |
| NMK49_RS11880 | 2410185..2410451 | - | 267 | WP_000074048.1 | Txe/YoeB family addiction module toxin | Toxin |
| NMK49_RS11885 | 2410451..2410708 | - | 258 | WP_000587616.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NMK49_RS11890 | 2411067..2411522 | + | 456 | WP_000732082.1 | DUF1307 domain-containing protein | - |
| NMK49_RS11895 | 2411690..2413267 | - | 1578 | WP_000143503.1 | FMN-binding glutamate synthase family protein | - |
| NMK49_RS11900 | 2413462..2414211 | + | 750 | WP_000072443.1 | CPBP family lipoprotein N-acylation protein LnsB | - |
| NMK49_RS11905 | 2414435..2415628 | - | 1194 | WP_000675401.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10648.23 Da Isoelectric Point: 10.1384
>T251440 WP_000074048.1 NZ_CP101124:c2410451-2410185 [Staphylococcus aureus subsp. aureus RN4220]
MSNYTVKIKNSAKSDLKKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLI
LSAWSHYD
MSNYTVKIKNSAKSDLKKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLI
LSAWSHYD
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|