Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 2353332..2353849 | Replicon | chromosome |
Accession | NZ_CP101124 | ||
Organism | Staphylococcus aureus subsp. aureus RN4220 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | T1YC79 |
Locus tag | NMK49_RS11605 | Protein ID | WP_000113262.1 |
Coordinates | 2353332..2353598 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | T1YB60 |
Locus tag | NMK49_RS11610 | Protein ID | WP_000584499.1 |
Coordinates | 2353598..2353849 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK49_RS11575 | 2348758..2349294 | - | 537 | WP_000169315.1 | GNAT family N-acetyltransferase | - |
NMK49_RS11580 | 2349527..2350351 | - | 825 | WP_000572040.1 | formate/nitrite transporter family protein | - |
NMK49_RS11585 | 2350568..2350750 | - | 183 | WP_000230294.1 | hypothetical protein | - |
NMK49_RS11590 | 2350834..2351301 | - | 468 | WP_000153344.1 | SRPBCC domain-containing protein | - |
NMK49_RS11595 | 2351487..2353037 | - | 1551 | WP_000727762.1 | zinc ABC transporter substrate-binding lipoprotein AdcA | - |
NMK49_RS11600 | 2353226..2353297 | - | 72 | Protein_2237 | hypothetical protein | - |
NMK49_RS11605 | 2353332..2353598 | - | 267 | WP_000113262.1 | Txe/YoeB family addiction module toxin | Toxin |
NMK49_RS11610 | 2353598..2353849 | - | 252 | WP_000584499.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NMK49_RS11615 | 2354014..2354115 | - | 102 | WP_001791744.1 | hypothetical protein | - |
NMK49_RS11620 | 2354122..2354721 | - | 600 | WP_000162813.1 | DsbA family protein | - |
NMK49_RS11625 | 2354740..2355102 | - | 363 | WP_000819843.1 | DUF4467 domain-containing protein | - |
NMK49_RS11630 | 2355357..2356607 | + | 1251 | WP_001012222.1 | FemA/FemB family glycyltransferase FmhA | - |
NMK49_RS11635 | 2356704..2357435 | - | 732 | WP_000615461.1 | amino acid ABC transporter ATP-binding protein | - |
NMK49_RS11640 | 2357432..2358151 | - | 720 | WP_000479576.1 | amino acid ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10437.95 Da Isoelectric Point: 9.9143
>T251438 WP_000113262.1 NZ_CP101124:c2353598-2353332 [Staphylococcus aureus subsp. aureus RN4220]
MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIK
IASCKYHY
MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIK
IASCKYHY
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|