Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1795408..1795590 | Replicon | chromosome |
| Accession | NZ_CP101124 | ||
| Organism | Staphylococcus aureus subsp. aureus RN4220 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NMK49_RS08590 | Protein ID | WP_001801861.1 |
| Coordinates | 1795408..1795503 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1795531..1795590 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK49_RS08550 | 1791068..1791694 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| NMK49_RS08555 | 1791735..1792079 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| NMK49_RS08560 | 1792177..1792728 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| NMK49_RS08565 | 1792946..1793587 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NMK49_RS08570 | 1793701..1793886 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| NMK49_RS08575 | 1793888..1794064 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| NMK49_RS08580 | 1794075..1794458 | - | 384 | WP_000070812.1 | hypothetical protein | - |
| NMK49_RS08585 | 1795062..1795205 | - | 144 | WP_001549059.1 | transposase | - |
| NMK49_RS08590 | 1795408..1795503 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1795531..1795590 | - | 60 | - | - | Antitoxin |
| NMK49_RS08595 | 1795626..1795727 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| NMK49_RS08600 | 1795705..1795881 | - | 177 | Protein_1690 | transposase | - |
| NMK49_RS08605 | 1796075..1796452 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T251434 WP_001801861.1 NZ_CP101124:1795408-1795503 [Staphylococcus aureus subsp. aureus RN4220]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT251434 NZ_CP101124:c1795590-1795531 [Staphylococcus aureus subsp. aureus RN4220]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|