Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2909031..2909454 Replicon chromosome
Accession NZ_CP101123
Organism Staphylococcus aureus strain MN8

Toxin (Protein)


Gene name higB Uniprot ID A0A5S9I4Y6
Locus tag NLA26_RS14580 Protein ID WP_001065091.1
Coordinates 2909031..2909282 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E0VQM8
Locus tag NLA26_RS14585 Protein ID WP_000028422.1
Coordinates 2909272..2909454 (+) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLA26_RS14535 (2904686) 2904686..2905606 + 921 WP_000138472.1 recombinase RecT -
NLA26_RS14540 (2905687) 2905687..2906304 + 618 WP_071621397.1 MBL fold metallo-hydrolase -
NLA26_RS14545 (2906305) 2906305..2906775 + 471 WP_000934764.1 single-stranded DNA-binding protein -
NLA26_RS14550 (2906805) 2906805..2907689 + 885 WP_000148316.1 DnaD domain protein -
NLA26_RS14555 (2907696) 2907696..2907914 + 219 WP_000338531.1 hypothetical protein -
NLA26_RS14560 (2907923) 2907923..2908232 + 310 Protein_2829 RusA family crossover junction endodeoxyribonuclease -
NLA26_RS14565 (2908245) 2908245..2908613 + 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
NLA26_RS14570 (2908617) 2908617..2908859 + 243 WP_000131366.1 SAV1978 family virulence-associated passenger protein -
NLA26_RS14575 (2908871) 2908871..2909038 + 168 WP_001624242.1 hypothetical protein -
NLA26_RS14580 (2909031) 2909031..2909282 + 252 WP_001065091.1 DUF1024 family protein Toxin
NLA26_RS14585 (2909272) 2909272..2909454 + 183 WP_000028422.1 hypothetical protein Antitoxin
NLA26_RS14590 (2909447) 2909447..2909989 + 543 WP_000185659.1 dUTP pyrophosphatase -
NLA26_RS14595 (2910026) 2910026..2910232 + 207 WP_000195803.1 DUF1381 domain-containing protein -
NLA26_RS14600 (2910229) 2910229..2910615 + 387 WP_000592207.1 hypothetical protein -
NLA26_RS14605 (2910612) 2910612..2910761 + 150 WP_000595265.1 transcriptional activator RinB -
NLA26_RS14610 (2910761) 2910761..2910961 + 201 WP_000265043.1 DUF1514 family protein -
NLA26_RS14615 (2910989) 2910989..2911405 + 417 WP_000590122.1 hypothetical protein -
NLA26_RS14620 (2911637) 2911637..2911936 + 300 WP_000988330.1 HNH endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - groEL / tsst-1 / hlb 2869394..2911936 42542


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9349.22 Da        Isoelectric Point: 3.9473

>T251432 WP_001065091.1 NZ_CP101123:2909031-2909282 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEH

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6741.63 Da        Isoelectric Point: 4.2658

>AT251432 WP_000028422.1 NZ_CP101123:2909272-2909454 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEEQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5S9I4Y6

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VQM8

References