Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2453688..2453872 | Replicon | chromosome |
| Accession | NZ_CP101123 | ||
| Organism | Staphylococcus aureus strain MN8 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | NLA26_RS12130 | Protein ID | WP_000482647.1 |
| Coordinates | 2453688..2453795 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2453812..2453872 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLA26_RS12105 | 2449050..2449523 | + | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
| NLA26_RS12110 | 2449646..2450857 | - | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
| NLA26_RS12115 | 2451039..2451698 | - | 660 | WP_000831298.1 | membrane protein | - |
| NLA26_RS12120 | 2451758..2452900 | - | 1143 | WP_001176855.1 | glycerate kinase | - |
| NLA26_RS12125 | 2453168..2453554 | + | 387 | WP_000779351.1 | flippase GtxA | - |
| NLA26_RS12130 | 2453688..2453795 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| NLA26_RS12135 | 2454443..2456206 | + | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein | - |
| NLA26_RS12140 | 2456231..2457964 | + | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein | - |
| NLA26_RS12145 | 2458195..2458362 | + | 168 | Protein_2360 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T251425 WP_000482647.1 NZ_CP101123:2453688-2453795 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT251425 NZ_CP101123:c2453872-2453812 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|