Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 963222..963645 Replicon chromosome
Accession NZ_CP101123
Organism Staphylococcus aureus strain MN8

Toxin (Protein)


Gene name higB Uniprot ID A0A6B5KJM6
Locus tag NLA26_RS04895 Protein ID WP_001065110.1
Coordinates 963394..963645 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E1X568
Locus tag NLA26_RS04890 Protein ID WP_000028425.1
Coordinates 963222..963404 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLA26_RS04850 (958615) 958615..958905 - 291 WP_000665205.1 VRR-NUC domain-containing protein -
NLA26_RS04855 (959039) 959039..959143 + 105 WP_015978074.1 hypothetical protein -
NLA26_RS04860 (959246) 959246..961693 - 2448 WP_000884879.1 virulence-associated E family protein -
NLA26_RS04865 (961746) 961746..961946 - 201 WP_000265258.1 DUF1514 family protein -
NLA26_RS04870 (962014) 962014..962166 - 153 WP_000595237.1 transcriptional activator RinB -
NLA26_RS04875 (962159) 962159..962395 - 237 WP_000483477.1 hypothetical protein -
NLA26_RS04880 (962420) 962420..962656 - 237 WP_000195806.1 DUF1381 domain-containing protein -
NLA26_RS04885 (962693) 962693..963229 - 537 WP_000185703.1 dUTPase -
NLA26_RS04890 (963222) 963222..963404 - 183 WP_000028425.1 hypothetical protein Antitoxin
NLA26_RS04895 (963394) 963394..963645 - 252 WP_001065110.1 DUF1024 family protein Toxin
NLA26_RS04900 (963660) 963660..963902 - 243 WP_000132193.1 SAV1978 family virulence-associated passenger protein -
NLA26_RS04905 (963917) 963917..964117 - 201 WP_000235324.1 hypothetical protein -
NLA26_RS04910 (964120) 964120..964377 - 258 WP_000022730.1 DUF3310 domain-containing protein -
NLA26_RS04915 (964377) 964377..964778 - 402 WP_000113974.1 PVL family protein -
NLA26_RS04920 (964778) 964778..964963 - 186 WP_001164629.1 DUF3113 family protein -
NLA26_RS04925 (964976) 964976..966928 - 1953 WP_078056499.1 DNA polymerase -
NLA26_RS04930 (966996) 966996..967552 - 557 Protein_942 DUF2815 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 931831..994321 62490


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9405.32 Da        Isoelectric Point: 3.8051

>T251421 WP_001065110.1 NZ_CP101123:c963645-963394 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKARAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6781.65 Da        Isoelectric Point: 4.4421

>AT251421 WP_000028425.1 NZ_CP101123:c963404-963222 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDGSIISLIDFVIKPIHLIKEAQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6B5KJM6

Antitoxin

Source ID Structure
AlphaFold DB A0A0E1X568

References