Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 221679..221859 | Replicon | chromosome |
| Accession | NZ_CP101123 | ||
| Organism | Staphylococcus aureus strain MN8 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NLA26_RS01440 | Protein ID | WP_001801861.1 |
| Coordinates | 221764..221859 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 221679..221736 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLA26_RS01415 | 217092..219512 | - | 2421 | WP_000182553.1 | polysaccharide lyase 8 family protein | - |
| NLA26_RS01420 | 220037..220479 | + | 443 | Protein_244 | DUF1433 domain-containing protein | - |
| NLA26_RS01425 | 220479..220922 | + | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| NLA26_RS01430 | 220922..221365 | + | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
| NLA26_RS01435 | 221540..221641 | - | 102 | WP_001791232.1 | hypothetical protein | - |
| - | 221679..221736 | + | 58 | - | - | Antitoxin |
| NLA26_RS01440 | 221764..221859 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| NLA26_RS01445 | 222310..222756 | + | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| NLA26_RS01450 | 222949..223518 | + | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NLA26_RS01455 | 223518..224885 | + | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
| NLA26_RS01460 | 225034..225606 | - | 573 | WP_000414222.1 | hypothetical protein | - |
| NLA26_RS01465 | 225704..226048 | - | 345 | WP_000627550.1 | DUF3969 family protein | - |
| NLA26_RS01470 | 226089..226715 | - | 627 | WP_000669038.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T251420 WP_001801861.1 NZ_CP101123:c221859-221764 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT251420 NZ_CP101123:221679-221736 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|