Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 20060..20367 | Replicon | chromosome |
| Accession | NZ_CP101123 | ||
| Organism | Staphylococcus aureus strain MN8 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | NLA26_RS00110 | Protein ID | WP_011447039.1 |
| Coordinates | 20060..20236 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 20228..20367 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLA26_RS00090 (17841) | 17841..17993 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| NLA26_RS00095 (18040) | 18040..18327 | + | 288 | WP_001040259.1 | hypothetical protein | - |
| NLA26_RS00100 (18383) | 18383..18757 | + | 375 | WP_000340977.1 | hypothetical protein | - |
| NLA26_RS00105 (19178) | 19178..19951 | + | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| NLA26_RS00110 (20060) | 20060..20236 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (20228) | 20228..20367 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (20228) | 20228..20367 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (20228) | 20228..20367 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (20228) | 20228..20367 | - | 140 | NuclAT_0 | - | Antitoxin |
| NLA26_RS00115 (20289) | 20289..20396 | - | 108 | WP_001791821.1 | hypothetical protein | - |
| NLA26_RS00120 (20448) | 20448..20702 | + | 255 | WP_000611512.1 | phage holin | - |
| NLA26_RS00125 (20714) | 20714..21469 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| NLA26_RS00130 (21660) | 21660..22151 | + | 492 | WP_000919350.1 | staphylokinase | - |
| NLA26_RS00135 (22801) | 22801..23136 | + | 336 | Protein_26 | SH3 domain-containing protein | - |
| NLA26_RS00140 (23231) | 23231..23680 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| NLA26_RS00145 (24366) | 24366..24716 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| NLA26_RS00150 (24769) | 24769..25029 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sea / sak / chp / scn | 1..24716 | 24715 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T251417 WP_011447039.1 NZ_CP101123:20060-20236 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT251417 NZ_CP101123:c20367-20228 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
