Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 807289..807916 | Replicon | chromosome |
| Accession | NZ_CP101114 | ||
| Organism | Bartonella harrusi strain 117A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NMK50_RS03745 | Protein ID | WP_254770917.1 |
| Coordinates | 807289..807603 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | NMK50_RS03750 | Protein ID | WP_004861504.1 |
| Coordinates | 807620..807916 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK50_RS03725 (NMK50_03725) | 802938..804482 | - | 1545 | WP_254770914.1 | phage portal protein | - |
| NMK50_RS03730 (NMK50_03730) | 804482..804730 | - | 249 | WP_254769754.1 | hypothetical protein | - |
| NMK50_RS03735 (NMK50_03735) | 804734..806662 | - | 1929 | WP_254770916.1 | phage terminase large subunit family protein | - |
| NMK50_RS03740 (NMK50_03740) | 806655..807236 | - | 582 | WP_254769752.1 | hypothetical protein | - |
| NMK50_RS03745 (NMK50_03745) | 807289..807603 | + | 315 | WP_254770917.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NMK50_RS03750 (NMK50_03750) | 807620..807916 | + | 297 | WP_004861504.1 | HigA family addiction module antitoxin | Antitoxin |
| NMK50_RS03755 (NMK50_03755) | 807958..808236 | - | 279 | WP_254770918.1 | hypothetical protein | - |
| NMK50_RS03760 (NMK50_03760) | 808233..808961 | - | 729 | WP_254770919.1 | antA/AntB antirepressor family protein | - |
| NMK50_RS03765 (NMK50_03765) | 809520..810062 | - | 543 | WP_254770920.1 | hypothetical protein | - |
| NMK50_RS03770 (NMK50_03770) | 810105..810425 | - | 321 | WP_254770921.1 | hypothetical protein | - |
| NMK50_RS03775 (NMK50_03775) | 810742..811284 | - | 543 | WP_254770922.1 | hypothetical protein | - |
| NMK50_RS03780 (NMK50_03780) | 811294..811734 | - | 441 | WP_254770923.1 | single-stranded DNA-binding protein | - |
| NMK50_RS03785 (NMK50_03785) | 811970..812161 | + | 192 | WP_254770924.1 | hypothetical protein | - |
| NMK50_RS03790 (NMK50_03790) | 812232..812660 | + | 429 | WP_254770925.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 772342..828802 | 56460 | |
| - | inside | Prophage | - | - | 772342..824434 | 52092 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12165.95 Da Isoelectric Point: 9.0985
>T251409 WP_254770917.1 NZ_CP101114:807289-807603 [Bartonella harrusi]
MIHKRTNEGDFVIESFADKRCKDLLEGNPPRGFPPTLVRIAQRKLFMLDKAVDLKDLRSPPGNRLEALKGERKGQYSIRI
NDQFRICFEWRSNGAYEVEIVDYH
MIHKRTNEGDFVIESFADKRCKDLLEGNPPRGFPPTLVRIAQRKLFMLDKAVDLKDLRSPPGNRLEALKGERKGQYSIRI
NDQFRICFEWRSNGAYEVEIVDYH
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|