Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4190831..4191483 | Replicon | chromosome |
Accession | NZ_CP100765 | ||
Organism | Serratia nematodiphila strain SASK3000 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NLX84_RS19920 | Protein ID | WP_048324788.1 |
Coordinates | 4190831..4191175 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A086GAN0 |
Locus tag | NLX84_RS19925 | Protein ID | WP_004931828.1 |
Coordinates | 4191181..4191483 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLX84_RS19910 (NLX84_19910) | 4187173..4189431 | - | 2259 | WP_135638586.1 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
NLX84_RS19915 (NLX84_19915) | 4189652..4190671 | + | 1020 | WP_135638588.1 | HTH-type transcriptional regulator GalR | - |
NLX84_RS19920 (NLX84_19920) | 4190831..4191175 | + | 345 | WP_048324788.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLX84_RS19925 (NLX84_19925) | 4191181..4191483 | + | 303 | WP_004931828.1 | XRE family transcriptional regulator | Antitoxin |
NLX84_RS19930 (NLX84_19930) | 4191511..4192773 | - | 1263 | WP_060560144.1 | diaminopimelate decarboxylase | - |
NLX84_RS19935 (NLX84_19935) | 4192907..4193830 | + | 924 | WP_021505677.1 | LysR family transcriptional regulator | - |
NLX84_RS19940 (NLX84_19940) | 4193858..4194766 | - | 909 | WP_085058844.1 | LysR family transcriptional regulator | - |
NLX84_RS19945 (NLX84_19945) | 4194875..4195759 | + | 885 | WP_004931820.1 | MBL fold metallo-hydrolase | - |
NLX84_RS19950 (NLX84_19950) | 4195834..4196481 | + | 648 | WP_033632219.1 | DsbA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13330.40 Da Isoelectric Point: 10.0507
>T251402 WP_048324788.1 NZ_CP100765:4190831-4191175 [Serratia nematodiphila]
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGCPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGCPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|