Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 581223..581876 | Replicon | chromosome |
| Accession | NZ_CP100764 | ||
| Organism | Serratia plymuthica strain SASK2000 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7U3YYL4 |
| Locus tag | NLX81_RS02730 | Protein ID | WP_013811355.1 |
| Coordinates | 581223..581573 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NLX81_RS02735 | Protein ID | WP_013811356.1 |
| Coordinates | 581577..581876 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX81_RS02705 (NLX81_02705) | 576702..577793 | + | 1092 | WP_004949798.1 | dimethyl sulfone monooxygenase SfnG | - |
| NLX81_RS02710 (NLX81_02710) | 577795..578496 | - | 702 | WP_006323392.1 | trehalose-6-phosphate synthase | - |
| NLX81_RS02715 (NLX81_02715) | 578511..579050 | - | 540 | WP_013811352.1 | GNAT family N-acetyltransferase | - |
| NLX81_RS02720 (NLX81_02720) | 579108..580487 | - | 1380 | WP_013811353.1 | glutamine synthetase family protein | - |
| NLX81_RS02725 (NLX81_02725) | 580743..581057 | + | 315 | WP_013811354.1 | hypothetical protein | - |
| NLX81_RS02730 (NLX81_02730) | 581223..581573 | + | 351 | WP_013811355.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLX81_RS02735 (NLX81_02735) | 581577..581876 | + | 300 | WP_013811356.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NLX81_RS02740 (NLX81_02740) | 581969..583045 | - | 1077 | WP_013811357.1 | YncE family protein | - |
| NLX81_RS02745 (NLX81_02745) | 583331..584554 | - | 1224 | WP_239440976.1 | Bcr/CflA family efflux MFS transporter | - |
| NLX81_RS02750 (NLX81_02750) | 584599..585822 | - | 1224 | WP_013811359.1 | cytochrome P450 | - |
| NLX81_RS02755 (NLX81_02755) | 585837..586094 | - | 258 | WP_013811360.1 | acyl carrier protein | - |
| NLX81_RS02760 (NLX81_02760) | 586141..586692 | - | 552 | WP_254754845.1 | NADPH-dependent FMN reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13456.56 Da Isoelectric Point: 8.5393
>T251377 WP_013811355.1 NZ_CP100764:581223-581573 [Serratia plymuthica]
MWTVITTEEFDRWFAVQDELTQEKVLAALVLLERSGPNLSRPFVDSLRGSQHPNMKELRVQHKGRPIRAFFAFDSLRQAI
VLCAGDKTGNEKRFYKVMLPIADAQFTQHLMCNFKE
MWTVITTEEFDRWFAVQDELTQEKVLAALVLLERSGPNLSRPFVDSLRGSQHPNMKELRVQHKGRPIRAFFAFDSLRQAI
VLCAGDKTGNEKRFYKVMLPIADAQFTQHLMCNFKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|