Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1494593..1495210 | Replicon | chromosome |
| Accession | NZ_CP100755 | ||
| Organism | Alcaligenes sp. NLF5-7 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | MID00_RS07025 | Protein ID | WP_250756474.1 |
| Coordinates | 1494593..1494889 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | MID00_RS07030 | Protein ID | WP_254500079.1 |
| Coordinates | 1494899..1495210 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MID00_RS07010 (MID00_07010) | 1490380..1491273 | - | 894 | WP_254500078.1 | MurR/RpiR family transcriptional regulator | - |
| MID00_RS07015 (MID00_07015) | 1491438..1491716 | - | 279 | WP_009460160.1 | acylphosphatase | - |
| MID00_RS07020 (MID00_07020) | 1491909..1494458 | + | 2550 | WP_250756475.1 | EAL domain-containing protein | - |
| MID00_RS07025 (MID00_07025) | 1494593..1494889 | + | 297 | WP_250756474.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MID00_RS07030 (MID00_07030) | 1494899..1495210 | + | 312 | WP_254500079.1 | HigA family addiction module antitoxin | Antitoxin |
| MID00_RS07035 (MID00_07035) | 1495279..1496646 | - | 1368 | WP_251196990.1 | DNA recombination protein RmuC | - |
| MID00_RS07040 (MID00_07040) | 1496925..1497935 | + | 1011 | WP_254500080.1 | acyltransferase family protein | - |
| MID00_RS07045 (MID00_07045) | 1498128..1499375 | - | 1248 | WP_254500081.1 | D-amino acid dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11092.48 Da Isoelectric Point: 9.3459
>T251371 WP_250756474.1 NZ_CP100755:1494593-1494889 [Alcaligenes sp. NLF5-7]
MIKSFRHKGLQAYFETGSKSGIQAKHAVRLQIQLTALHAATQAEDMNAPGWKLHKLSGKNPKGQSVQDHYTISVSGNWRL
TFYFEGEDAVLVDYQDYH
MIKSFRHKGLQAYFETGSKSGIQAKHAVRLQIQLTALHAATQAEDMNAPGWKLHKLSGKNPKGQSVQDHYTISVSGNWRL
TFYFEGEDAVLVDYQDYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|