Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1324836..1325496 | Replicon | chromosome |
| Accession | NZ_CP100753 | ||
| Organism | Serratia marcescens strain SASK1000 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NLX77_RS06230 | Protein ID | WP_118891868.1 |
| Coordinates | 1324836..1325189 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A6G8TPX9 |
| Locus tag | NLX77_RS06235 | Protein ID | WP_004935502.1 |
| Coordinates | 1325194..1325496 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX77_RS06210 (NLX77_06210) | 1320939..1321304 | + | 366 | WP_004935528.1 | diacylglycerol kinase | - |
| NLX77_RS06215 (NLX77_06215) | 1321397..1322296 | + | 900 | WP_075686404.1 | LysR family transcriptional regulator | - |
| NLX77_RS06220 (NLX77_06220) | 1322271..1323077 | - | 807 | WP_118891867.1 | substrate-binding domain-containing protein | - |
| NLX77_RS06225 (NLX77_06225) | 1323104..1324399 | - | 1296 | WP_004935508.1 | MFS transporter | - |
| NLX77_RS06230 (NLX77_06230) | 1324836..1325189 | + | 354 | WP_118891868.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLX77_RS06235 (NLX77_06235) | 1325194..1325496 | + | 303 | WP_004935502.1 | XRE family transcriptional regulator | Antitoxin |
| NLX77_RS06240 (NLX77_06240) | 1325619..1326527 | - | 909 | WP_254520193.1 | LysR family transcriptional regulator | - |
| NLX77_RS06245 (NLX77_06245) | 1326666..1327586 | + | 921 | WP_031300707.1 | alpha/beta hydrolase | - |
| NLX77_RS06250 (NLX77_06250) | 1327586..1328522 | + | 937 | Protein_1218 | alpha/beta hydrolase | - |
| NLX77_RS06255 (NLX77_06255) | 1328538..1329173 | + | 636 | WP_015378474.1 | SDR family oxidoreductase | - |
| NLX77_RS06260 (NLX77_06260) | 1329216..1329944 | + | 729 | WP_226882923.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1315913..1332701 | 16788 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13575.59 Da Isoelectric Point: 9.0493
>T251359 WP_118891868.1 NZ_CP100753:1324836-1325189 [Serratia marcescens]
VWEIKTTDAFDHWLRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGM
VLCAGNKAGDEKRFYDRMLQIADREFTNWLNTLKEKE
VWEIKTTDAFDHWLRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGM
VLCAGNKAGDEKRFYDRMLQIADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|