Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 574023..574675 | Replicon | chromosome |
| Accession | NZ_CP100753 | ||
| Organism | Serratia marcescens strain SASK1000 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NLX77_RS02745 | Protein ID | WP_004931830.1 |
| Coordinates | 574331..574675 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A086GAN0 |
| Locus tag | NLX77_RS02740 | Protein ID | WP_004931828.1 |
| Coordinates | 574023..574325 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX77_RS02715 (NLX77_02715) | 569030..569677 | - | 648 | WP_015378930.1 | DsbA family protein | - |
| NLX77_RS02720 (NLX77_02720) | 569746..570630 | - | 885 | WP_254520113.1 | MBL fold metallo-hydrolase | - |
| NLX77_RS02725 (NLX77_02725) | 570739..571647 | + | 909 | WP_015378928.1 | LysR family transcriptional regulator | - |
| NLX77_RS02730 (NLX77_02730) | 571675..572598 | - | 924 | WP_254520114.1 | LysR family transcriptional regulator | - |
| NLX77_RS02735 (NLX77_02735) | 572733..573995 | + | 1263 | WP_004931826.1 | diaminopimelate decarboxylase | - |
| NLX77_RS02740 (NLX77_02740) | 574023..574325 | - | 303 | WP_004931828.1 | XRE family transcriptional regulator | Antitoxin |
| NLX77_RS02745 (NLX77_02745) | 574331..574675 | - | 345 | WP_004931830.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLX77_RS02750 (NLX77_02750) | 574835..575854 | - | 1020 | WP_004931832.1 | HTH-type transcriptional regulator GalR | - |
| NLX77_RS02755 (NLX77_02755) | 576076..578334 | + | 2259 | WP_118891741.1 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13383.44 Da Isoelectric Point: 10.6087
>T251357 WP_004931830.1 NZ_CP100753:c574675-574331 [Serratia marcescens]
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|