Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 213542..214170 | Replicon | chromosome |
| Accession | NZ_CP100753 | ||
| Organism | Serratia marcescens strain SASK1000 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A6M5HY34 |
| Locus tag | NLX77_RS01020 | Protein ID | WP_048325546.1 |
| Coordinates | 213880..214170 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A8B4GQY7 |
| Locus tag | NLX77_RS01015 | Protein ID | WP_015379150.1 |
| Coordinates | 213542..213865 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX77_RS00990 (NLX77_00990) | 208554..209789 | - | 1236 | WP_004937146.1 | serine/threonine transporter SstT | - |
| NLX77_RS00995 (NLX77_00995) | 210052..211017 | - | 966 | WP_049241556.1 | TerC family protein | - |
| NLX77_RS01000 (NLX77_01000) | 211273..212004 | - | 732 | WP_015379152.1 | glutamine amidotransferase | - |
| NLX77_RS01005 (NLX77_01005) | 212006..212986 | - | 981 | WP_004937152.1 | Gfo/Idh/MocA family oxidoreductase | - |
| NLX77_RS01010 (NLX77_01010) | 213037..213549 | - | 513 | WP_016930176.1 | M48 family metallopeptidase | - |
| NLX77_RS01015 (NLX77_01015) | 213542..213865 | - | 324 | WP_015379150.1 | HigA family addiction module antitoxin | Antitoxin |
| NLX77_RS01020 (NLX77_01020) | 213880..214170 | - | 291 | WP_048325546.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLX77_RS01025 (NLX77_01025) | 214401..215540 | + | 1140 | WP_015379148.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| NLX77_RS01030 (NLX77_01030) | 215735..217756 | - | 2022 | WP_118891652.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11627.31 Da Isoelectric Point: 10.2325
>T251355 WP_048325546.1 NZ_CP100753:c214170-213880 [Serratia marcescens]
MIKSFRDRYLEQFYLEGKRSRLIPGVLERQLARKLDILAAAQQERDLHHPTGNYYKRLSGPFQGWSSLRVNMHWRLMFQW
RHDAAEKIYLDPHQDT
MIKSFRDRYLEQFYLEGKRSRLIPGVLERQLARKLDILAAAQQERDLHHPTGNYYKRLSGPFQGWSSLRVNMHWRLMFQW
RHDAAEKIYLDPHQDT
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6M5HY34 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4GQY7 |