Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 157373..158103 | Replicon | chromosome |
Accession | NZ_CP100753 | ||
Organism | Serratia marcescens strain SASK1000 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NLX77_RS00715 | Protein ID | WP_118891648.1 |
Coordinates | 157792..158103 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NLX77_RS00710 | Protein ID | WP_015379178.1 |
Coordinates | 157373..157795 (-) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLX77_RS00695 (NLX77_00695) | 153232..153972 | + | 741 | WP_004937022.1 | KDGP aldolase family protein | - |
NLX77_RS00700 (NLX77_00700) | 154187..155401 | + | 1215 | WP_015379180.1 | lactonase family protein | - |
NLX77_RS00705 (NLX77_00705) | 155453..157369 | + | 1917 | WP_254520073.1 | PRD domain-containing protein | - |
NLX77_RS00710 (NLX77_00710) | 157373..157795 | - | 423 | WP_015379178.1 | helix-turn-helix domain-containing protein | Antitoxin |
NLX77_RS00715 (NLX77_00715) | 157792..158103 | - | 312 | WP_118891648.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NLX77_RS00720 (NLX77_00720) | 158401..158670 | - | 270 | Protein_136 | PTS phosphocarrier protein NPr | - |
NLX77_RS00725 (NLX77_00725) | 158667..159521 | - | 855 | WP_015379177.1 | RNase adapter RapZ | - |
NLX77_RS00730 (NLX77_00730) | 159649..160110 | - | 462 | WP_016930212.1 | PTS IIA-like nitrogen regulatory protein PtsN | - |
NLX77_RS00735 (NLX77_00735) | 160266..160553 | - | 288 | WP_004937038.1 | ribosome hibernation promoting factor | - |
NLX77_RS00740 (NLX77_00740) | 160577..162010 | - | 1434 | WP_021505109.1 | RNA polymerase factor sigma-54 | - |
NLX77_RS00745 (NLX77_00745) | 162063..162788 | - | 726 | WP_254520074.1 | LPS export ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12319.16 Da Isoelectric Point: 10.0957
>T251354 WP_118891648.1 NZ_CP100753:c158103-157792 [Serratia marcescens]
MHIISREPFNNATKQYPNEATALEAIYKTLRRGEFRTPDELKALFPSLDRMKYKEKWWVIDVGGNHLRILFFASFETQKV
FIKHIVSHAEYDKLMQHYRRSSS
MHIISREPFNNATKQYPNEATALEAIYKTLRRGEFRTPDELKALFPSLDRMKYKEKWWVIDVGGNHLRILFFASFETQKV
FIKHIVSHAEYDKLMQHYRRSSS
Download Length: 312 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15784.13 Da Isoelectric Point: 5.2139
>AT251354 WP_015379178.1 NZ_CP100753:c157795-157373 [Serratia marcescens]
MITDAIKAADALLRAVPLLQGSRAQQDYREALELVEYLLENDEHHPLIDMLAKKIAEYEDNSAEFTAFNQRIAQLPQGVA
ALRVLMEQHQLSQSDFEHEIGKKSLVNQILNGKRSLTIPHIMALAKRFNLPPALFLPEAD
MITDAIKAADALLRAVPLLQGSRAQQDYREALELVEYLLENDEHHPLIDMLAKKIAEYEDNSAEFTAFNQRIAQLPQGVA
ALRVLMEQHQLSQSDFEHEIGKKSLVNQILNGKRSLTIPHIMALAKRFNLPPALFLPEAD
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|