Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4543922..4544676 | Replicon | chromosome |
| Accession | NZ_CP100744 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain R18.0234 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | FGU68_RS21950 | Protein ID | WP_000558166.1 |
| Coordinates | 4543922..4544233 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | FGU68_RS21955 | Protein ID | WP_001259011.1 |
| Coordinates | 4544230..4544676 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGU68_RS21920 (4539580) | 4539580..4540482 | + | 903 | WP_000331365.1 | formate dehydrogenase subunit beta | - |
| FGU68_RS21925 (4540479) | 4540479..4541114 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| FGU68_RS21930 (4541111) | 4541111..4542040 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| FGU68_RS21935 (4542087) | 4542087..4542377 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| FGU68_RS21940 (4542378) | 4542378..4542689 | - | 312 | WP_001159632.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| FGU68_RS21945 (4542907) | 4542907..4543836 | + | 930 | WP_001127702.1 | alpha/beta hydrolase | - |
| FGU68_RS21950 (4543922) | 4543922..4544233 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| FGU68_RS21955 (4544230) | 4544230..4544676 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| FGU68_RS21960 (4544691) | 4544691..4545632 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| FGU68_RS21965 (4545677) | 4545677..4546114 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| FGU68_RS21970 (4546111) | 4546111..4546983 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| FGU68_RS21975 (4546977) | 4546977..4547576 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| FGU68_RS21980 (4547767) | 4547767..4548570 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| FGU68_RS21985 (4548604) | 4548604..4549500 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T251336 WP_000558166.1 NZ_CP100744:4543922-4544233 [Salmonella enterica subsp. enterica serovar Newport]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT251336 WP_001259011.1 NZ_CP100744:4544230-4544676 [Salmonella enterica subsp. enterica serovar Newport]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|