Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4593047..4593649 | Replicon | chromosome |
| Accession | NZ_CP100739 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.0292 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | NL736_RS22230 | Protein ID | WP_001159630.1 |
| Coordinates | 4593338..4593649 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL736_RS22225 | Protein ID | WP_000362050.1 |
| Coordinates | 4593047..4593337 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL736_RS22210 (4590540) | 4590540..4591442 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NL736_RS22215 (4591439) | 4591439..4592074 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL736_RS22220 (4592071) | 4592071..4593000 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL736_RS22225 (4593047) | 4593047..4593337 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| NL736_RS22230 (4593338) | 4593338..4593649 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| NL736_RS22235 (4593867) | 4593867..4594796 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NL736_RS22240 (4594882) | 4594882..4595193 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
| NL736_RS22245 (4595190) | 4595190..4595636 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| NL736_RS22250 (4595651) | 4595651..4596592 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL736_RS22255 (4596637) | 4596637..4597074 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NL736_RS22260 (4597071) | 4597071..4597943 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NL736_RS22265 (4597937) | 4597937..4598536 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T251318 WP_001159630.1 NZ_CP100739:c4593649-4593338 [Salmonella enterica subsp. enterica serovar Typhimurium]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT251318 WP_000362050.1 NZ_CP100739:c4593337-4593047 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|