Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2356939..2357461 | Replicon | chromosome |
Accession | NZ_CP100739 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.0292 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NL736_RS11340 | Protein ID | WP_000221343.1 |
Coordinates | 2357177..2357461 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NL736_RS11335 | Protein ID | WP_000885424.1 |
Coordinates | 2356939..2357187 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL736_RS11310 (2352155) | 2352155..2353621 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NL736_RS11315 (2354429) | 2354429..2355143 | + | 715 | Protein_2212 | helix-turn-helix domain-containing protein | - |
NL736_RS11320 (2355199) | 2355199..2356107 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NL736_RS11325 (2356250) | 2356250..2356582 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NL736_RS11330 (2356572) | 2356572..2356787 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NL736_RS11335 (2356939) | 2356939..2357187 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL736_RS11340 (2357177) | 2357177..2357461 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL736_RS11345 (2357632) | 2357632..2358021 | + | 390 | WP_000194089.1 | RidA family protein | - |
NL736_RS11350 (2358073) | 2358073..2359152 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NL736_RS11355 (2359345) | 2359345..2359833 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NL736_RS11360 (2359878) | 2359878..2361386 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2352158..2364243 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T251311 WP_000221343.1 NZ_CP100739:2357177-2357461 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |