Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4605869..4606623 | Replicon | chromosome |
| Accession | NZ_CP100736 | ||
| Organism | Salmonella enterica subsp. enterica serovar Agona strain R18.1477 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NL742_RS22215 | Protein ID | WP_000558166.1 |
| Coordinates | 4605869..4606180 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL742_RS22220 | Protein ID | WP_001259011.1 |
| Coordinates | 4606177..4606623 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL742_RS22185 (4601527) | 4601527..4602429 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| NL742_RS22190 (4602426) | 4602426..4603061 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL742_RS22195 (4603058) | 4603058..4603987 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL742_RS22200 (4604034) | 4604034..4604324 | - | 291 | WP_000362051.1 | NadS family protein | - |
| NL742_RS22205 (4604325) | 4604325..4604636 | - | 312 | WP_001159632.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NL742_RS22210 (4604854) | 4604854..4605783 | + | 930 | WP_001127697.1 | alpha/beta hydrolase | - |
| NL742_RS22215 (4605869) | 4605869..4606180 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL742_RS22220 (4606177) | 4606177..4606623 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NL742_RS22225 (4606638) | 4606638..4607579 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL742_RS22230 (4607624) | 4607624..4608061 | - | 438 | WP_000560973.1 | D-aminoacyl-tRNA deacylase | - |
| NL742_RS22235 (4608058) | 4608058..4608930 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NL742_RS22240 (4608924) | 4608924..4609523 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NL742_RS22245 (4609714) | 4609714..4610517 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NL742_RS22250 (4610551) | 4610551..4611447 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T251298 WP_000558166.1 NZ_CP100736:4605869-4606180 [Salmonella enterica subsp. enterica serovar Agona]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT251298 WP_001259011.1 NZ_CP100736:4606177-4606623 [Salmonella enterica subsp. enterica serovar Agona]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|