Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 2696258..2696985 Replicon chromosome
Accession NZ_CP100736
Organism Salmonella enterica subsp. enterica serovar Agona strain R18.1477

Toxin (Protein)


Gene name higB Uniprot ID V7IQW2
Locus tag NL742_RS13070 Protein ID WP_000558158.1
Coordinates 2696258..2696569 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NL742_RS13075 Protein ID WP_000561389.1
Coordinates 2696566..2696985 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL742_RS13035 (2691425) 2691425..2692147 - 723 WP_000182066.1 SPI-1 type III secretion system guanine nucleotide exchange factor SopE2 -
NL742_RS13040 (2692832) 2692832..2693227 + 396 WP_000422887.1 DUF1398 domain-containing protein -
NL742_RS13045 (2693556) 2693556..2694032 + 477 WP_000030944.1 hypothetical protein -
NL742_RS13050 (2694142) 2694142..2694336 + 195 WP_023134800.1 hypothetical protein -
NL742_RS13055 (2694699) 2694699..2695481 + 783 WP_001747695.1 DUF2971 domain-containing protein -
NL742_RS13060 (2695535) 2695535..2695750 - 216 WP_001747696.1 hypothetical protein -
NL742_RS13065 (2695780) 2695780..2696079 - 300 WP_000775225.1 hypothetical protein -
NL742_RS13070 (2696258) 2696258..2696569 + 312 WP_000558158.1 type II toxin-antitoxin system HigB family toxin Toxin
NL742_RS13075 (2696566) 2696566..2696985 + 420 WP_000561389.1 helix-turn-helix domain-containing protein Antitoxin
NL742_RS13080 (2697241) 2697241..2697735 + 495 WP_016419152.1 glycosyltransferase -
NL742_RS13085 (2697732) 2697732..2697890 + 159 WP_023165344.1 lipopolysaccharide 1,2-N-acetylglucosaminetransferase -
NL742_RS13090 (2698126) 2698126..2698545 - 420 WP_000354404.1 GNAT family N-acetyltransferase -
NL742_RS13095 (2698916) 2698916..2699185 + 270 WP_077905753.1 hypothetical protein -
NL742_RS13100 (2699351) 2699351..2699491 + 141 WP_000489598.1 hypothetical protein -
NL742_RS13105 (2699637) 2699637..2700179 - 543 Protein_2565 IS256 family transposase -
NL742_RS13110 (2700199) 2700199..2700291 - 93 WP_231923105.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2699637..2700314 677


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(22-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(85-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12398.19 Da        Isoelectric Point: 10.0279

>T251286 WP_000558158.1 NZ_CP100736:2696258-2696569 [Salmonella enterica subsp. enterica serovar Agona]
MHVISKEPFDEAARRYPNDSLAIKALYRLVREKDFSSPAELRTVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15301.49 Da        Isoelectric Point: 4.6286

>AT251286 WP_000561389.1 NZ_CP100736:2696566-2696985 [Salmonella enterica subsp. enterica serovar Agona]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V7IQW2

Antitoxin

Source ID Structure

References