Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 41461..41725 Replicon plasmid pR18.1932_88k
Accession NZ_CP100734
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain R18.1932

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag NL737_RS24425 Protein ID WP_001303307.1
Coordinates 41573..41725 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 41461..41523 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL737_RS24410 (36700) 36700..38991 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
NL737_RS24415 (38984) 38984..40054 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
NL737_RS24420 (40073) 40073..41281 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (41461) 41461..41523 - 63 NuclAT_0 - Antitoxin
- (41461) 41461..41523 - 63 NuclAT_0 - Antitoxin
- (41461) 41461..41523 - 63 NuclAT_0 - Antitoxin
- (41461) 41461..41523 - 63 NuclAT_0 - Antitoxin
NL737_RS24425 (41573) 41573..41725 + 153 WP_001303307.1 Hok/Gef family protein Toxin
NL737_RS24430 (41797) 41797..42048 - 252 WP_001291964.1 hypothetical protein -
NL737_RS24435 (42348) 42348..42644 + 297 WP_001275298.1 DinQ-like type I toxin DqlB -
NL737_RS24440 (42709) 42709..42885 - 177 WP_001054904.1 hypothetical protein -
NL737_RS24445 (43277) 43277..43486 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
NL737_RS24450 (43558) 43558..44220 - 663 WP_000653334.1 plasmid IncI1-type surface exclusion protein ExcA -
NL737_RS24455 (44285) 44285..46447 - 2163 WP_000698351.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..87844 87844


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T251278 WP_001303307.1 NZ_CP100734:41573-41725 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT251278 NZ_CP100734:c41523-41461 [Salmonella enterica subsp. enterica serovar Typhimurium]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References