Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 41461..41725 | Replicon | plasmid pR18.1932_88k |
| Accession | NZ_CP100734 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.1932 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | NL737_RS24425 | Protein ID | WP_001303307.1 |
| Coordinates | 41573..41725 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 41461..41523 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL737_RS24410 (36700) | 36700..38991 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| NL737_RS24415 (38984) | 38984..40054 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| NL737_RS24420 (40073) | 40073..41281 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (41461) | 41461..41523 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (41461) | 41461..41523 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (41461) | 41461..41523 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (41461) | 41461..41523 | - | 63 | NuclAT_0 | - | Antitoxin |
| NL737_RS24425 (41573) | 41573..41725 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| NL737_RS24430 (41797) | 41797..42048 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| NL737_RS24435 (42348) | 42348..42644 | + | 297 | WP_001275298.1 | DinQ-like type I toxin DqlB | - |
| NL737_RS24440 (42709) | 42709..42885 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| NL737_RS24445 (43277) | 43277..43486 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| NL737_RS24450 (43558) | 43558..44220 | - | 663 | WP_000653334.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| NL737_RS24455 (44285) | 44285..46447 | - | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..87844 | 87844 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T251278 WP_001303307.1 NZ_CP100734:41573-41725 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT251278 NZ_CP100734:c41523-41461 [Salmonella enterica subsp. enterica serovar Typhimurium]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|