Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4594881..4595635 | Replicon | chromosome |
| Accession | NZ_CP100732 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.1932 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NL737_RS22235 | Protein ID | WP_000558166.1 |
| Coordinates | 4594881..4595192 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL737_RS22240 | Protein ID | WP_001259011.1 |
| Coordinates | 4595189..4595635 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL737_RS22205 (4590539) | 4590539..4591441 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NL737_RS22210 (4591438) | 4591438..4592073 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL737_RS22215 (4592070) | 4592070..4592999 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL737_RS22220 (4593046) | 4593046..4593336 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NL737_RS22225 (4593337) | 4593337..4593648 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NL737_RS22230 (4593866) | 4593866..4594795 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NL737_RS22235 (4594881) | 4594881..4595192 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL737_RS22240 (4595189) | 4595189..4595635 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NL737_RS22245 (4595650) | 4595650..4596591 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL737_RS22250 (4596636) | 4596636..4597073 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NL737_RS22255 (4597070) | 4597070..4597942 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NL737_RS22260 (4597936) | 4597936..4598535 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NL737_RS22265 (4598726) | 4598726..4599529 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NL737_RS22270 (4599563) | 4599563..4600459 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T251275 WP_000558166.1 NZ_CP100732:4594881-4595192 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT251275 WP_001259011.1 NZ_CP100732:4595189-4595635 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|