Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 21676..22387 | Replicon | plasmid pR17.0776_84k |
| Accession | NZ_CP100729 | ||
| Organism | Salmonella enterica subsp. enterica serovar Blockley strain R17.0776 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | I2UJZ0 |
| Locus tag | NL731_RS24240 | Protein ID | WP_000162415.1 |
| Coordinates | 21676..21978 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL731_RS24245 | Protein ID | WP_000806445.1 |
| Coordinates | 22049..22387 (+) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL731_RS24210 (NL731_24210) | 16695..17315 | - | 621 | WP_044862276.1 | hypothetical protein | - |
| NL731_RS24215 (NL731_24215) | 17359..18264 | - | 906 | WP_032342061.1 | recombination-associated protein RdgC | - |
| NL731_RS24220 (NL731_24220) | 18324..18977 | - | 654 | WP_032342060.1 | hypothetical protein | - |
| NL731_RS24225 (NL731_24225) | 18974..19954 | - | 981 | WP_047647145.1 | hypothetical protein | - |
| NL731_RS24230 (NL731_24230) | 19958..20725 | - | 768 | WP_000203293.1 | hypothetical protein | - |
| NL731_RS24235 (NL731_24235) | 20722..21513 | - | 792 | WP_063074813.1 | hypothetical protein | - |
| NL731_RS24240 (NL731_24240) | 21676..21978 | + | 303 | WP_000162415.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL731_RS24245 (NL731_24245) | 22049..22387 | + | 339 | WP_000806445.1 | HigA family addiction module antitoxin | Antitoxin |
| NL731_RS24250 (NL731_24250) | 22444..22629 | + | 186 | Protein_28 | hypothetical protein | - |
| NL731_RS24255 (NL731_24255) | 22666..23394 | + | 729 | WP_063074812.1 | hypothetical protein | - |
| NL731_RS24260 (NL731_24260) | 23428..24621 | - | 1194 | WP_063074560.1 | hypothetical protein | - |
| NL731_RS24265 (NL731_24265) | 24614..24943 | - | 330 | WP_000542383.1 | hypothetical protein | - |
| NL731_RS24270 (NL731_24270) | 25272..25925 | - | 654 | WP_086776826.1 | maturation control protein | - |
| NL731_RS24275 (NL731_24275) | 26271..27104 | + | 834 | WP_226149389.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | floR | - | 1..83642 | 83642 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11818.56 Da Isoelectric Point: 9.8739
>T251255 WP_000162415.1 NZ_CP100729:21676-21978 [Salmonella enterica subsp. enterica serovar Blockley]
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCKDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCKDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Download Length: 113 a.a. Molecular weight: 13049.98 Da Isoelectric Point: 6.4754
>AT251255 WP_000806445.1 NZ_CP100729:22049-22387 [Salmonella enterica subsp. enterica serovar Blockley]
MKQATRKPTTVGDILLYEYLEPLELKINELAEILHVHRNTVSALVNNNRKLTMDMAYRLAKAFDTSVDFWINLQTAVDLW
EVENDMRVQEELSRINTAEKFISQRNLNKKAA
MKQATRKPTTVGDILLYEYLEPLELKINELAEILHVHRNTVSALVNNNRKLTMDMAYRLAKAFDTSVDFWINLQTAVDLW
EVENDMRVQEELSRINTAEKFISQRNLNKKAA
Download Length: 339 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|