Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4733423..4734177 | Replicon | chromosome |
| Accession | NZ_CP100728 | ||
| Organism | Salmonella enterica subsp. enterica serovar Blockley strain R17.0776 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | NL731_RS23180 | Protein ID | WP_000558163.1 |
| Coordinates | 4733423..4733734 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL731_RS23185 | Protein ID | WP_001259011.1 |
| Coordinates | 4733731..4734177 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL731_RS23150 (4729081) | 4729081..4729983 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| NL731_RS23155 (4729980) | 4729980..4730615 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL731_RS23160 (4730612) | 4730612..4731541 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL731_RS23165 (4731588) | 4731588..4731878 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NL731_RS23170 (4731879) | 4731879..4732190 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NL731_RS23175 (4732408) | 4732408..4733337 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| NL731_RS23180 (4733423) | 4733423..4733734 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL731_RS23185 (4733731) | 4733731..4734177 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NL731_RS23190 (4734192) | 4734192..4735133 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL731_RS23195 (4735178) | 4735178..4735615 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| NL731_RS23200 (4735612) | 4735612..4736484 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NL731_RS23205 (4736478) | 4736478..4737077 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NL731_RS23210 (4737268) | 4737268..4738071 | - | 804 | WP_000059694.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NL731_RS23215 (4738105) | 4738105..4739001 | - | 897 | WP_064047151.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T251254 WP_000558163.1 NZ_CP100728:4733423-4733734 [Salmonella enterica subsp. enterica serovar Blockley]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT251254 WP_001259011.1 NZ_CP100728:4733731-4734177 [Salmonella enterica subsp. enterica serovar Blockley]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|