Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4560687..4561289 | Replicon | chromosome |
Accession | NZ_CP100724 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain R17.1476 |
Toxin (Protein)
Gene name | higB | Uniprot ID | M7S4R6 |
Locus tag | NL714_RS22325 | Protein ID | WP_001159635.1 |
Coordinates | 4560978..4561289 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NL714_RS22320 | Protein ID | WP_000362050.1 |
Coordinates | 4560687..4560977 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL714_RS22305 (4558180) | 4558180..4559082 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
NL714_RS22310 (4559079) | 4559079..4559714 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
NL714_RS22315 (4559711) | 4559711..4560640 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
NL714_RS22320 (4560687) | 4560687..4560977 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
NL714_RS22325 (4560978) | 4560978..4561289 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
NL714_RS22330 (4561507) | 4561507..4562436 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
NL714_RS22335 (4562522) | 4562522..4562833 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | - |
NL714_RS22340 (4562830) | 4562830..4563276 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
NL714_RS22345 (4563291) | 4563291..4564232 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
NL714_RS22350 (4564277) | 4564277..4564714 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
NL714_RS22355 (4564711) | 4564711..4565583 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
NL714_RS22360 (4565577) | 4565577..4566176 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T251234 WP_001159635.1 NZ_CP100724:c4561289-4560978 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT251234 WP_000362050.1 NZ_CP100724:c4560977-4560687 [Salmonella enterica subsp. enterica serovar Enteritidis]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|