Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 904183..904808 | Replicon | chromosome |
| Accession | NZ_CP100724 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain R17.1476 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | M7SD17 |
| Locus tag | NL714_RS04290 | Protein ID | WP_000911336.1 |
| Coordinates | 904183..904581 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | NL714_RS04295 | Protein ID | WP_000557549.1 |
| Coordinates | 904581..904808 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL714_RS04275 (900860) | 900860..901441 | - | 582 | WP_001244651.1 | fimbrial protein | - |
| NL714_RS04280 (902160) | 902160..902792 | - | 633 | WP_000835265.1 | YfdX family protein | - |
| NL714_RS04285 (902839) | 902839..903375 | - | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
| NL714_RS04290 (904183) | 904183..904581 | - | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NL714_RS04295 (904581) | 904581..904808 | - | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NL714_RS04300 (905017) | 905017..905268 | + | 252 | WP_001576352.1 | hypothetical protein | - |
| NL714_RS04305 (905548) | 905548..906354 | + | 807 | WP_001574939.1 | DUF1460 domain-containing protein | - |
| NL714_RS04315 (906639) | 906639..907397 | - | 759 | WP_000244328.1 | amidase activator ActS | - |
| NL714_RS04320 (907662) | 907662..908207 | + | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| NL714_RS04325 (908283) | 908283..909800 | - | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 895744..906354 | 10610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T251218 WP_000911336.1 NZ_CP100724:c904581-904183 [Salmonella enterica subsp. enterica serovar Enteritidis]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFC | |
| PDB | 6IFM |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFM | |
| AlphaFold DB | A0A3V2Y5V5 |