Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4760385..4761139 | Replicon | chromosome |
| Accession | NZ_CP100715 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R17.5474 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NL730_RS23355 | Protein ID | WP_000558166.1 |
| Coordinates | 4760385..4760696 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL730_RS23360 | Protein ID | WP_001259011.1 |
| Coordinates | 4760693..4761139 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL730_RS23325 (4756043) | 4756043..4756945 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NL730_RS23330 (4756942) | 4756942..4757577 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL730_RS23335 (4757574) | 4757574..4758503 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL730_RS23340 (4758550) | 4758550..4758840 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NL730_RS23345 (4758841) | 4758841..4759152 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NL730_RS23350 (4759370) | 4759370..4760299 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NL730_RS23355 (4760385) | 4760385..4760696 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL730_RS23360 (4760693) | 4760693..4761139 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NL730_RS23365 (4761154) | 4761154..4762095 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL730_RS23370 (4762140) | 4762140..4762577 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NL730_RS23375 (4762574) | 4762574..4763446 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NL730_RS23380 (4763440) | 4763440..4764039 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NL730_RS23385 (4764230) | 4764230..4765033 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NL730_RS23390 (4765067) | 4765067..4765963 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T251191 WP_000558166.1 NZ_CP100715:4760385-4760696 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT251191 WP_001259011.1 NZ_CP100715:4760693-4761139 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|