Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2424847..2425369 | Replicon | chromosome |
Accession | NZ_CP100715 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R17.5474 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NL730_RS11945 | Protein ID | WP_000221343.1 |
Coordinates | 2425085..2425369 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NL730_RS11940 | Protein ID | WP_000885424.1 |
Coordinates | 2424847..2425095 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL730_RS11915 (2420063) | 2420063..2421529 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NL730_RS11920 (2422337) | 2422337..2423051 | + | 715 | Protein_2332 | helix-turn-helix domain-containing protein | - |
NL730_RS11925 (2423107) | 2423107..2424015 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NL730_RS11930 (2424158) | 2424158..2424490 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NL730_RS11935 (2424480) | 2424480..2424695 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NL730_RS11940 (2424847) | 2424847..2425095 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL730_RS11945 (2425085) | 2425085..2425369 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL730_RS11950 (2425540) | 2425540..2425929 | + | 390 | WP_000194089.1 | RidA family protein | - |
NL730_RS11955 (2425981) | 2425981..2427060 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NL730_RS11960 (2427253) | 2427253..2427741 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NL730_RS11965 (2427786) | 2427786..2429294 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2420066..2432151 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T251183 WP_000221343.1 NZ_CP100715:2425085-2425369 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |