Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 21049..21760 | Replicon | plasmid pR18.0186_78k |
| Accession | NZ_CP100711 | ||
| Organism | Salmonella enterica subsp. enterica serovar Blockley strain R18.0186 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | I2UJZ0 |
| Locus tag | NL733_RS24060 | Protein ID | WP_000162415.1 |
| Coordinates | 21458..21760 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL733_RS24055 | Protein ID | WP_000806445.1 |
| Coordinates | 21049..21387 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL733_RS24025 (NL733_24025) | 16332..17165 | - | 834 | WP_226149389.1 | hypothetical protein | - |
| NL733_RS24030 (NL733_24030) | 17511..18164 | + | 654 | WP_086776826.1 | maturation control protein | - |
| NL733_RS24035 (NL733_24035) | 18493..18822 | + | 330 | WP_000542383.1 | hypothetical protein | - |
| NL733_RS24040 (NL733_24040) | 18815..20008 | + | 1194 | WP_063074560.1 | hypothetical protein | - |
| NL733_RS24045 (NL733_24045) | 20042..20770 | - | 729 | WP_063074812.1 | hypothetical protein | - |
| NL733_RS24050 (NL733_24050) | 20807..20992 | - | 186 | Protein_37 | hypothetical protein | - |
| NL733_RS24055 (NL733_24055) | 21049..21387 | - | 339 | WP_000806445.1 | HigA family addiction module antitoxin | Antitoxin |
| NL733_RS24060 (NL733_24060) | 21458..21760 | - | 303 | WP_000162415.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL733_RS24065 (NL733_24065) | 21923..22714 | + | 792 | WP_063074813.1 | hypothetical protein | - |
| NL733_RS24070 (NL733_24070) | 22711..23478 | + | 768 | WP_000203293.1 | hypothetical protein | - |
| NL733_RS24075 (NL733_24075) | 23482..24462 | + | 981 | WP_047647145.1 | hypothetical protein | - |
| NL733_RS24080 (NL733_24080) | 24459..25112 | + | 654 | WP_032342060.1 | hypothetical protein | - |
| NL733_RS24085 (NL733_24085) | 25172..26077 | + | 906 | WP_032342061.1 | recombination-associated protein RdgC | - |
| NL733_RS24090 (NL733_24090) | 26121..26741 | + | 621 | WP_044862276.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | floR | - | 1..77896 | 77896 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11818.56 Da Isoelectric Point: 9.8739
>T251172 WP_000162415.1 NZ_CP100711:c21760-21458 [Salmonella enterica subsp. enterica serovar Blockley]
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCKDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCKDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Download Length: 113 a.a. Molecular weight: 13049.98 Da Isoelectric Point: 6.4754
>AT251172 WP_000806445.1 NZ_CP100711:c21387-21049 [Salmonella enterica subsp. enterica serovar Blockley]
MKQATRKPTTVGDILLYEYLEPLELKINELAEILHVHRNTVSALVNNNRKLTMDMAYRLAKAFDTSVDFWINLQTAVDLW
EVENDMRVQEELSRINTAEKFISQRNLNKKAA
MKQATRKPTTVGDILLYEYLEPLELKINELAEILHVHRNTVSALVNNNRKLTMDMAYRLAKAFDTSVDFWINLQTAVDLW
EVENDMRVQEELSRINTAEKFISQRNLNKKAA
Download Length: 339 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|