Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4698999..4699601 | Replicon | chromosome |
| Accession | NZ_CP100710 | ||
| Organism | Salmonella enterica subsp. enterica serovar Blockley strain R18.0186 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | M7S4R6 |
| Locus tag | NL733_RS22925 | Protein ID | WP_001159635.1 |
| Coordinates | 4699290..4699601 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL733_RS22920 | Protein ID | WP_000362050.1 |
| Coordinates | 4698999..4699289 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL733_RS22905 (4696492) | 4696492..4697394 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| NL733_RS22910 (4697391) | 4697391..4698026 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL733_RS22915 (4698023) | 4698023..4698952 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL733_RS22920 (4698999) | 4698999..4699289 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| NL733_RS22925 (4699290) | 4699290..4699601 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| NL733_RS22930 (4699819) | 4699819..4700748 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| NL733_RS22935 (4700834) | 4700834..4701145 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | - |
| NL733_RS22940 (4701142) | 4701142..4701588 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| NL733_RS22945 (4701603) | 4701603..4702544 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL733_RS22950 (4702589) | 4702589..4703026 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| NL733_RS22955 (4703023) | 4703023..4703895 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NL733_RS22960 (4703889) | 4703889..4704488 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T251169 WP_001159635.1 NZ_CP100710:c4699601-4699290 [Salmonella enterica subsp. enterica serovar Blockley]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT251169 WP_000362050.1 NZ_CP100710:c4699289-4698999 [Salmonella enterica subsp. enterica serovar Blockley]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|