Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4767602..4768356 | Replicon | chromosome |
| Accession | NZ_CP100707 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.0409 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NL735_RS23405 | Protein ID | WP_000558166.1 |
| Coordinates | 4767602..4767913 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL735_RS23410 | Protein ID | WP_001259011.1 |
| Coordinates | 4767910..4768356 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL735_RS23375 (4763260) | 4763260..4764162 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NL735_RS23380 (4764159) | 4764159..4764794 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL735_RS23385 (4764791) | 4764791..4765720 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL735_RS23390 (4765767) | 4765767..4766057 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NL735_RS23395 (4766058) | 4766058..4766369 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NL735_RS23400 (4766587) | 4766587..4767516 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NL735_RS23405 (4767602) | 4767602..4767913 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL735_RS23410 (4767910) | 4767910..4768356 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NL735_RS23415 (4768371) | 4768371..4769312 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL735_RS23420 (4769357) | 4769357..4769794 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NL735_RS23425 (4769791) | 4769791..4770663 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NL735_RS23430 (4770657) | 4770657..4771256 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NL735_RS23435 (4771447) | 4771447..4772250 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NL735_RS23440 (4772284) | 4772284..4773180 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T251146 WP_000558166.1 NZ_CP100707:4767602-4767913 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT251146 WP_001259011.1 NZ_CP100707:4767910-4768356 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|