Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2433404..2433926 | Replicon | chromosome |
| Accession | NZ_CP100707 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.0409 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | B5F5Y5 |
| Locus tag | NL735_RS12005 | Protein ID | WP_000221343.1 |
| Coordinates | 2433642..2433926 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | NL735_RS12000 | Protein ID | WP_000885424.1 |
| Coordinates | 2433404..2433652 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL735_RS11975 (2428620) | 2428620..2430086 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
| NL735_RS11980 (2430894) | 2430894..2431608 | + | 715 | Protein_2344 | helix-turn-helix domain-containing protein | - |
| NL735_RS11985 (2431664) | 2431664..2432572 | - | 909 | WP_010989018.1 | hypothetical protein | - |
| NL735_RS11990 (2432715) | 2432715..2433047 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
| NL735_RS11995 (2433037) | 2433037..2433252 | - | 216 | WP_000206207.1 | hypothetical protein | - |
| NL735_RS12000 (2433404) | 2433404..2433652 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NL735_RS12005 (2433642) | 2433642..2433926 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL735_RS12010 (2434097) | 2434097..2434486 | + | 390 | WP_000194089.1 | RidA family protein | - |
| NL735_RS12015 (2434538) | 2434538..2435617 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| NL735_RS12020 (2435810) | 2435810..2436298 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| NL735_RS12025 (2436343) | 2436343..2437851 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 2428623..2440708 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T251138 WP_000221343.1 NZ_CP100707:2433642-2433926 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JSW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |