Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47918..48182 | Replicon | plasmid pR18.0872_93k |
| Accession | NZ_CP100704 | ||
| Organism | Salmonella enterica subsp. enterica serovar Thompson strain R18.0872 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | NL734_RS24425 | Protein ID | WP_001387489.1 |
| Coordinates | 48030..48182 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 47918..47978 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL734_RS24400 (43510) | 43510..43827 | + | 318 | WP_000118520.1 | quaternary ammonium compound efflux SMR transporter SugE | - |
| NL734_RS24405 (43824) | 43824..44357 | - | 534 | WP_001221666.1 | lipocalin family protein | - |
| NL734_RS24410 (44451) | 44451..45596 | - | 1146 | WP_000976514.1 | class C beta-lactamase CMY-2 | - |
| NL734_RS24415 (45920) | 45920..47182 | - | 1263 | WP_000608644.1 | IS1380-like element ISEcp1 family transposase | - |
| NL734_RS24420 (47335) | 47335..47709 | - | 375 | WP_223349261.1 | hypothetical protein | - |
| - (47918) | 47918..47978 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (47918) | 47918..47978 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (47918) | 47918..47978 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (47918) | 47918..47978 | - | 61 | NuclAT_0 | - | Antitoxin |
| NL734_RS24425 (48030) | 48030..48182 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| NL734_RS24430 (48254) | 48254..48505 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| NL734_RS24435 (48805) | 48805..49101 | + | 297 | WP_011264046.1 | DinQ-like type I toxin DqlB | - |
| NL734_RS24440 (49166) | 49166..49342 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| NL734_RS24445 (49734) | 49734..49943 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| NL734_RS24450 (50015) | 50015..50677 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| NL734_RS24455 (50748) | 50748..52916 | - | 2169 | WP_023518847.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCMY-2 | - | 1..93173 | 93173 | |
| - | flank | IS/Tn | blaCMY-2 | - | 44451..47182 | 2731 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T251124 WP_001387489.1 NZ_CP100704:48030-48182 [Salmonella enterica subsp. enterica serovar Thompson]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT251124 NZ_CP100704:c47978-47918 [Salmonella enterica subsp. enterica serovar Thompson]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
