Detailed information of TA system TA251122

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/COG4683-HTH_37
• Location: 13609..14266
• Replicon: plasmid pR18.0872_149k
• Accession: NZ_CP100703
• Organism: Salmonella enterica subsp. enterica serovar Thompson strain R18.0872

Toxin (Protein)

• Gene name: higB
• Uniprot ID: U3PDC3
• Locus tag: NL734_RS23385
• Protein ID: WP_000270043.1
• Coordinates: 13916..14266 (-)
• Length: 117 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: NL734_RS23380
• Protein ID: WP_000124640.1
• Coordinates: 13609..13911 (-)
• Length: 101 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NL734_RS23335 (NL734_23335)	9234..9662	+	429	WP_000591074.1	hypothetical protein	-
NL734_RS23340 (NL734_23340)	9719..10078	+	360	WP_000422768.1	hypothetical protein	-
NL734_RS23345 (NL734_23345)	10078..10524	+	447	WP_000919345.1	Fe3+-siderophore ABC transporter permease	-
NL734_RS23350 (NL734_23350)	10521..11039	+	519	WP_000210756.1	nitrite reductase	-
NL734_RS23355 (NL734_23355)	11039..11269	+	231	WP_000972663.1	hypothetical protein	-
NL734_RS23360 (NL734_23360)	11256..12113	+	858	WP_001167032.1	hypothetical protein	-
NL734_RS23365 (NL734_23365)	12344..12871	+	528	WP_001236377.1	thermonuclease family protein	-
NL734_RS23370 (NL734_23370)	12929..13201	+	273	WP_001043047.1	HU family DNA-binding protein	-
NL734_RS23375 (NL734_23375)	13289..13582	+	294	WP_001239997.1	chromosome segregation protein ParM	-
NL734_RS23380 (NL734_23380)	13609..13911	-	303	WP_000124640.1	XRE family transcriptional regulator	Antitoxin
NL734_RS23385 (NL734_23385)	13916..14266	-	351	WP_000270043.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
NL734_RS23390 (NL734_23390)	14429..14977	+	549	WP_001061574.1	transcriptional regulator	-
NL734_RS23395 (NL734_23395)	15318..15512	+	195	WP_000343597.1	hypothetical protein	-
NL734_RS23400 (NL734_23400)	15523..15894	+	372	WP_000516916.1	hypothetical protein	-
NL734_RS23405 (NL734_23405)	15887..16357	+	471	WP_001281821.1	hypothetical protein	-
NL734_RS23410 (NL734_23410)	16372..16707	-	336	WP_000683476.1	hypothetical protein	-
NL734_RS23415 (NL734_23415)	16804..17292	+	489	WP_001273096.1	DUF1643 domain-containing protein	-
NL734_RS23420 (NL734_23420)	17295..17792	+	498	WP_000062185.1	hypothetical protein	-
NL734_RS23425 (NL734_23425)	18007..18711	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
NL734_RS23430 (NL734_23430)	18776..18955	-	180	Protein_31	helix-turn-helix domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	mph(A) / dfrA12 / aadA2 / qacE / sul1 / qnrS1 / blaCMY-2 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaTEM-1B	-	1..149266	149266

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-like (12-106)

Antitoxin

• Cro/C1-type helix-turn-helix domain (33-79)

Sequences

Toxin

Protein

• Length: 117 a.a.
• Molecular weight: 13328.21 Da
• Isoelectric Point: 5.2421

>T251122 WP_000270043.1 NZ_CP100703:c14266-13916 [Salmonella enterica subsp. enterica serovar Thompson]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Nucleotide

• Length: 351 bp

Antitoxin

Protein

• Length: 101 a.a.
• Molecular weight: 11006.73 Da
• Isoelectric Point: 7.2036

>AT251122 WP_000124640.1 NZ_CP100703:c13911-13609 [Salmonella enterica subsp. enterica serovar Thompson]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Nucleotide

• Length: 303 bp

Structures

Toxin

• AlphaFold DB: A0A7G8AFB9