Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4573301..4574055 | Replicon | chromosome |
| Accession | NZ_CP100702 | ||
| Organism | Salmonella enterica subsp. enterica serovar Thompson strain R18.0872 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5I4V816 |
| Locus tag | NL734_RS22340 | Protein ID | WP_017465947.1 |
| Coordinates | 4573301..4573612 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL734_RS22345 | Protein ID | WP_017465948.1 |
| Coordinates | 4573609..4574055 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL734_RS22310 (4568959) | 4568959..4569861 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| NL734_RS22315 (4569858) | 4569858..4570493 | + | 636 | WP_000829028.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL734_RS22320 (4570490) | 4570490..4571419 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL734_RS22325 (4571466) | 4571466..4571756 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NL734_RS22330 (4571757) | 4571757..4572068 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NL734_RS22335 (4572286) | 4572286..4573215 | + | 930 | WP_001127708.1 | alpha/beta hydrolase | - |
| NL734_RS22340 (4573301) | 4573301..4573612 | + | 312 | WP_017465947.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL734_RS22345 (4573609) | 4573609..4574055 | + | 447 | WP_017465948.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NL734_RS22350 (4574070) | 4574070..4575011 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL734_RS22355 (4575056) | 4575056..4575493 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NL734_RS22360 (4575490) | 4575490..4576362 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NL734_RS22365 (4576356) | 4576356..4576955 | - | 600 | WP_001621364.1 | glucose-1-phosphatase | - |
| NL734_RS22370 (4577146) | 4577146..4577949 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NL734_RS22375 (4577983) | 4577983..4578879 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12384.31 Da Isoelectric Point: 9.2528
>T251121 WP_017465947.1 NZ_CP100702:4573301-4573612 [Salmonella enterica subsp. enterica serovar Thompson]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16736.06 Da Isoelectric Point: 6.6451
>AT251121 WP_017465948.1 NZ_CP100702:4573609-4574055 [Salmonella enterica subsp. enterica serovar Thompson]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|