Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4751604..4752358 | Replicon | chromosome |
| Accession | NZ_CP100695 | ||
| Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R18.0830 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | NL711_RS23050 | Protein ID | WP_000558163.1 |
| Coordinates | 4751604..4751915 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL711_RS23055 | Protein ID | WP_001259011.1 |
| Coordinates | 4751912..4752358 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL711_RS23020 (4747270) | 4747270..4748172 | + | 903 | WP_254519630.1 | formate dehydrogenase subunit beta | - |
| NL711_RS23025 (4748169) | 4748169..4748804 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL711_RS23030 (4748801) | 4748801..4749730 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL711_RS23035 (4749768) | 4749768..4750142 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| NL711_RS23040 (4750142) | 4750142..4750384 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| NL711_RS23045 (4750589) | 4750589..4751518 | + | 930 | WP_001162862.1 | alpha/beta hydrolase | - |
| NL711_RS23050 (4751604) | 4751604..4751915 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL711_RS23055 (4751912) | 4751912..4752358 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NL711_RS23060 (4752373) | 4752373..4753314 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL711_RS23065 (4753359) | 4753359..4753796 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| NL711_RS23070 (4753793) | 4753793..4754665 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NL711_RS23075 (4754659) | 4754659..4755258 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NL711_RS23080 (4755449) | 4755449..4756252 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NL711_RS23085 (4756286) | 4756286..4757182 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T251083 WP_000558163.1 NZ_CP100695:4751604-4751915 [Salmonella enterica subsp. enterica serovar Weltevreden]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT251083 WP_001259011.1 NZ_CP100695:4751912-4752358 [Salmonella enterica subsp. enterica serovar Weltevreden]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|