Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4531817..4532571 | Replicon | chromosome |
| Accession | NZ_CP100693 | ||
| Organism | Salmonella enterica subsp. enterica serovar London strain R18.1595 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | NL712_RS21865 | Protein ID | WP_000558163.1 |
| Coordinates | 4531817..4532128 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL712_RS21870 | Protein ID | WP_001259011.1 |
| Coordinates | 4532125..4532571 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL712_RS21835 (4527475) | 4527475..4528377 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NL712_RS21840 (4528374) | 4528374..4529009 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL712_RS21845 (4529006) | 4529006..4529935 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL712_RS21850 (4529982) | 4529982..4530272 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NL712_RS21855 (4530273) | 4530273..4530584 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NL712_RS21860 (4530802) | 4530802..4531731 | + | 930 | WP_023255277.1 | alpha/beta hydrolase | - |
| NL712_RS21865 (4531817) | 4531817..4532128 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL712_RS21870 (4532125) | 4532125..4532571 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NL712_RS21875 (4532586) | 4532586..4533527 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL712_RS21880 (4533572) | 4533572..4534009 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| NL712_RS21885 (4534006) | 4534006..4534878 | - | 873 | WP_023255278.1 | virulence factor BrkB family protein | - |
| NL712_RS21890 (4534872) | 4534872..4535471 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NL712_RS21895 (4535662) | 4535662..4536465 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NL712_RS21900 (4536499) | 4536499..4537395 | - | 897 | WP_001651900.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T251065 WP_000558163.1 NZ_CP100693:4531817-4532128 [Salmonella enterica subsp. enterica serovar London]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT251065 WP_001259011.1 NZ_CP100693:4532125-4532571 [Salmonella enterica subsp. enterica serovar London]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|