Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2329179..2329701 | Replicon | chromosome |
Accession | NZ_CP100693 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain R18.1595 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NL712_RS11225 | Protein ID | WP_000221343.1 |
Coordinates | 2329417..2329701 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NL712_RS11220 | Protein ID | WP_000885424.1 |
Coordinates | 2329179..2329427 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL712_RS11195 (2325272) | 2325272..2326738 | + | 1467 | WP_077946914.1 | hypothetical protein | - |
NL712_RS11200 (2327040) | 2327040..2327330 | + | 291 | WP_000742001.1 | hypothetical protein | - |
NL712_RS11205 (2327683) | 2327683..2328409 | + | 727 | Protein_2189 | helix-turn-helix domain-containing protein | - |
NL712_RS11210 (2328490) | 2328490..2328822 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NL712_RS11215 (2328812) | 2328812..2329027 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NL712_RS11220 (2329179) | 2329179..2329427 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL712_RS11225 (2329417) | 2329417..2329701 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL712_RS11230 (2329872) | 2329872..2330261 | + | 390 | WP_000194089.1 | RidA family protein | - |
NL712_RS11235 (2330313) | 2330313..2331392 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NL712_RS11240 (2331585) | 2331585..2332073 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NL712_RS11245 (2332118) | 2332118..2333626 | + | 1509 | WP_058214747.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2325275..2336483 | 11208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T251057 WP_000221343.1 NZ_CP100693:2329417-2329701 [Salmonella enterica subsp. enterica serovar London]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |