Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2544737..2545259 | Replicon | chromosome |
Accession | NZ_CP100691 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R17.3867 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NL690_RS12445 | Protein ID | WP_000221343.1 |
Coordinates | 2544975..2545259 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NL690_RS12440 | Protein ID | WP_000885424.1 |
Coordinates | 2544737..2544985 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL690_RS12415 (2539953) | 2539953..2541419 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NL690_RS12420 (2542227) | 2542227..2542941 | + | 715 | Protein_2431 | helix-turn-helix domain-containing protein | - |
NL690_RS12425 (2542997) | 2542997..2543905 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NL690_RS12430 (2544048) | 2544048..2544380 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NL690_RS12435 (2544370) | 2544370..2544585 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NL690_RS12440 (2544737) | 2544737..2544985 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL690_RS12445 (2544975) | 2544975..2545259 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL690_RS12450 (2545430) | 2545430..2545819 | + | 390 | WP_000194089.1 | RidA family protein | - |
NL690_RS12455 (2545871) | 2545871..2546950 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NL690_RS12460 (2547143) | 2547143..2547631 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NL690_RS12465 (2547676) | 2547676..2549184 | + | 1509 | WP_099949671.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2541701..2552041 | 10340 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T251043 WP_000221343.1 NZ_CP100691:2544975-2545259 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |