Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4559268..4560022 | Replicon | chromosome |
| Accession | NZ_CP100689 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain R18.0287 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | FGU70_RS22005 | Protein ID | WP_000558166.1 |
| Coordinates | 4559268..4559579 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | FGU70_RS22010 | Protein ID | WP_001259011.1 |
| Coordinates | 4559576..4560022 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGU70_RS21975 (4554926) | 4554926..4555828 | + | 903 | WP_000331365.1 | formate dehydrogenase subunit beta | - |
| FGU70_RS21980 (4555825) | 4555825..4556460 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| FGU70_RS21985 (4556457) | 4556457..4557386 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| FGU70_RS21990 (4557433) | 4557433..4557723 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| FGU70_RS21995 (4557724) | 4557724..4558035 | - | 312 | WP_001159632.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| FGU70_RS22000 (4558253) | 4558253..4559182 | + | 930 | WP_001127702.1 | alpha/beta hydrolase | - |
| FGU70_RS22005 (4559268) | 4559268..4559579 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| FGU70_RS22010 (4559576) | 4559576..4560022 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| FGU70_RS22015 (4560037) | 4560037..4560978 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| FGU70_RS22020 (4561023) | 4561023..4561460 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| FGU70_RS22025 (4561457) | 4561457..4562329 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| FGU70_RS22030 (4562323) | 4562323..4562922 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| FGU70_RS22035 (4563113) | 4563113..4563916 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| FGU70_RS22040 (4563950) | 4563950..4564846 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T251032 WP_000558166.1 NZ_CP100689:4559268-4559579 [Salmonella enterica subsp. enterica serovar Newport]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT251032 WP_001259011.1 NZ_CP100689:4559576-4560022 [Salmonella enterica subsp. enterica serovar Newport]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|