Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4452628..4453382 | Replicon | chromosome |
Accession | NZ_CP100685 | ||
Organism | Salmonella enterica subsp. enterica serovar Goldcoast strain R18.1297 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | FC640_RS21245 | Protein ID | WP_133323219.1 |
Coordinates | 4452628..4452939 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | FC640_RS21250 | Protein ID | WP_001259009.1 |
Coordinates | 4452936..4453382 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FC640_RS21215 (4448286) | 4448286..4449188 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
FC640_RS21220 (4449185) | 4449185..4449820 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
FC640_RS21225 (4449817) | 4449817..4450746 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
FC640_RS21230 (4450793) | 4450793..4451083 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
FC640_RS21235 (4451084) | 4451084..4451395 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
FC640_RS21240 (4451613) | 4451613..4452542 | + | 930 | WP_001127694.1 | alpha/beta hydrolase | - |
FC640_RS21245 (4452628) | 4452628..4452939 | + | 312 | WP_133323219.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
FC640_RS21250 (4452936) | 4452936..4453382 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
FC640_RS21255 (4453397) | 4453397..4454338 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
FC640_RS21260 (4454383) | 4454383..4454820 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
FC640_RS21265 (4454817) | 4454817..4455689 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
FC640_RS21270 (4455683) | 4455683..4456282 | - | 600 | WP_000965698.1 | glucose-1-phosphatase | - |
FC640_RS21275 (4456473) | 4456473..4457276 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
FC640_RS21280 (4457310) | 4457310..4458206 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12490.44 Da Isoelectric Point: 9.1995
>T251015 WP_133323219.1 NZ_CP100685:4452628-4452939 [Salmonella enterica subsp. enterica serovar Goldcoast]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSDNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSDNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT251015 WP_001259009.1 NZ_CP100685:4452936-4453382 [Salmonella enterica subsp. enterica serovar Goldcoast]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|