Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4452617..4453371 Replicon chromosome
Accession NZ_CP100682
Organism Salmonella enterica subsp. enterica serovar Goldcoast strain R18.0450

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag FC623_RS21250 Protein ID WP_133323219.1
Coordinates 4452617..4452928 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag FC623_RS21255 Protein ID WP_001259009.1
Coordinates 4452925..4453371 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FC623_RS21220 (4448275) 4448275..4449177 + 903 WP_000331364.1 formate dehydrogenase subunit beta -
FC623_RS21225 (4449174) 4449174..4449809 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
FC623_RS21230 (4449806) 4449806..4450735 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
FC623_RS21235 (4450782) 4450782..4451072 - 291 WP_000362050.1 DNA-binding transcriptional regulator -
FC623_RS21240 (4451073) 4451073..4451384 - 312 WP_001159630.1 cytotoxic translational repressor of toxin-antitoxin stability system -
FC623_RS21245 (4451602) 4451602..4452531 + 930 WP_001127694.1 alpha/beta hydrolase -
FC623_RS21250 (4452617) 4452617..4452928 + 312 WP_133323219.1 type II toxin-antitoxin system HigB family toxin Toxin
FC623_RS21255 (4452925) 4452925..4453371 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
FC623_RS21260 (4453386) 4453386..4454327 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
FC623_RS21265 (4454372) 4454372..4454809 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
FC623_RS21270 (4454806) 4454806..4455678 - 873 WP_000921423.1 virulence factor BrkB family protein -
FC623_RS21275 (4455672) 4455672..4456271 - 600 WP_000965698.1 glucose-1-phosphatase -
FC623_RS21280 (4456462) 4456462..4457265 - 804 WP_000059693.1 DeoR/GlpR family DNA-binding transcription regulator -
FC623_RS21285 (4457299) 4457299..4458195 - 897 WP_001520529.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12490.44 Da        Isoelectric Point: 9.1995

>T251000 WP_133323219.1 NZ_CP100682:4452617-4452928 [Salmonella enterica subsp. enterica serovar Goldcoast]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSDNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT251000 WP_001259009.1 NZ_CP100682:4452925-4453371 [Salmonella enterica subsp. enterica serovar Goldcoast]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References