Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4450782..4451384 | Replicon | chromosome |
| Accession | NZ_CP100682 | ||
| Organism | Salmonella enterica subsp. enterica serovar Goldcoast strain R18.0450 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | FC623_RS21240 | Protein ID | WP_001159630.1 |
| Coordinates | 4451073..4451384 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | FC623_RS21235 | Protein ID | WP_000362050.1 |
| Coordinates | 4450782..4451072 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FC623_RS21220 (4448275) | 4448275..4449177 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| FC623_RS21225 (4449174) | 4449174..4449809 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| FC623_RS21230 (4449806) | 4449806..4450735 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| FC623_RS21235 (4450782) | 4450782..4451072 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| FC623_RS21240 (4451073) | 4451073..4451384 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| FC623_RS21245 (4451602) | 4451602..4452531 | + | 930 | WP_001127694.1 | alpha/beta hydrolase | - |
| FC623_RS21250 (4452617) | 4452617..4452928 | + | 312 | WP_133323219.1 | type II toxin-antitoxin system HigB family toxin | - |
| FC623_RS21255 (4452925) | 4452925..4453371 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| FC623_RS21260 (4453386) | 4453386..4454327 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| FC623_RS21265 (4454372) | 4454372..4454809 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| FC623_RS21270 (4454806) | 4454806..4455678 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| FC623_RS21275 (4455672) | 4455672..4456271 | - | 600 | WP_000965698.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T250999 WP_001159630.1 NZ_CP100682:c4451384-4451073 [Salmonella enterica subsp. enterica serovar Goldcoast]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT250999 WP_000362050.1 NZ_CP100682:c4451072-4450782 [Salmonella enterica subsp. enterica serovar Goldcoast]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|