Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 42858..43122 Replicon plasmid pR17.0809_88k
Accession NZ_CP100679
Organism Salmonella enterica subsp. enterica serovar Anatum strain R17.0809

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag NL708_RS23155 Protein ID WP_001387489.1
Coordinates 42970..43122 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 42858..42918 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL708_RS23135 (38055) 38055..39200 - 1146 WP_000976514.1 class C beta-lactamase CMY-2 -
NL708_RS23145 (40860) 40860..42122 - 1263 WP_000608644.1 IS1380-like element ISEcp1 family transposase -
NL708_RS23150 (42275) 42275..42649 - 375 WP_223349261.1 hypothetical protein -
- (42858) 42858..42918 - 61 NuclAT_0 - Antitoxin
- (42858) 42858..42918 - 61 NuclAT_0 - Antitoxin
- (42858) 42858..42918 - 61 NuclAT_0 - Antitoxin
- (42858) 42858..42918 - 61 NuclAT_0 - Antitoxin
NL708_RS23155 (42970) 42970..43122 + 153 WP_001387489.1 Hok/Gef family protein Toxin
NL708_RS23160 (43194) 43194..43445 - 252 WP_001291964.1 hypothetical protein -
NL708_RS23165 (43745) 43745..44041 + 297 WP_011264046.1 DinQ-like type I toxin DqlB -
NL708_RS23170 (44106) 44106..44282 - 177 WP_001054897.1 hypothetical protein -
NL708_RS23175 (44674) 44674..44883 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
NL708_RS23180 (44955) 44955..45617 - 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
NL708_RS23185 (45688) 45688..47856 - 2169 WP_023518847.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCMY-2 - 1..88397 88397


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T250983 WP_001387489.1 NZ_CP100679:42970-43122 [Salmonella enterica subsp. enterica serovar Anatum]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT250983 NZ_CP100679:c42918-42858 [Salmonella enterica subsp. enterica serovar Anatum]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References