Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4542080..4542834 | Replicon | chromosome |
| Accession | NZ_CP100678 | ||
| Organism | Salmonella enterica subsp. enterica serovar Anatum strain R17.0809 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NL708_RS21955 | Protein ID | WP_000558166.1 |
| Coordinates | 4542080..4542391 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL708_RS21960 | Protein ID | WP_031609809.1 |
| Coordinates | 4542388..4542834 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL708_RS21925 (4537746) | 4537746..4538648 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| NL708_RS21930 (4538645) | 4538645..4539280 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL708_RS21935 (4539277) | 4539277..4540206 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL708_RS21940 (4540244) | 4540244..4540618 | - | 375 | WP_023243564.1 | type II toxin-antitoxin system VapC family toxin | - |
| NL708_RS21945 (4540618) | 4540618..4540860 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| NL708_RS21950 (4541065) | 4541065..4541994 | + | 930 | WP_001162860.1 | alpha/beta hydrolase | - |
| NL708_RS21955 (4542080) | 4542080..4542391 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL708_RS21960 (4542388) | 4542388..4542834 | + | 447 | WP_031609809.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NL708_RS21965 (4542849) | 4542849..4543790 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL708_RS21970 (4543835) | 4543835..4544272 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| NL708_RS21975 (4544269) | 4544269..4545141 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NL708_RS21980 (4545135) | 4545135..4545734 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NL708_RS21985 (4545925) | 4545925..4546728 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NL708_RS21990 (4546762) | 4546762..4547658 | - | 897 | WP_023243565.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T250982 WP_000558166.1 NZ_CP100678:4542080-4542391 [Salmonella enterica subsp. enterica serovar Anatum]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16721.00 Da Isoelectric Point: 6.0016
>AT250982 WP_031609809.1 NZ_CP100678:4542388-4542834 [Salmonella enterica subsp. enterica serovar Anatum]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEETPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEETPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|