Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3265416..3266073 | Replicon | chromosome |
| Accession | NZ_CP100678 | ||
| Organism | Salmonella enterica subsp. enterica serovar Anatum strain R17.0809 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | NL708_RS15945 | Protein ID | WP_000270043.1 |
| Coordinates | 3265416..3265766 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL708_RS15950 | Protein ID | WP_000124640.1 |
| Coordinates | 3265771..3266073 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL708_RS15905 (3260971) | 3260971..3261675 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NL708_RS15910 (3261890) | 3261890..3262387 | - | 498 | WP_000062185.1 | hypothetical protein | - |
| NL708_RS15915 (3262390) | 3262390..3262878 | - | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| NL708_RS15920 (3262975) | 3262975..3263310 | + | 336 | WP_000683476.1 | hypothetical protein | - |
| NL708_RS15925 (3263325) | 3263325..3263795 | - | 471 | WP_001281821.1 | hypothetical protein | - |
| NL708_RS15930 (3263788) | 3263788..3264159 | - | 372 | WP_000516916.1 | hypothetical protein | - |
| NL708_RS15935 (3264170) | 3264170..3264364 | - | 195 | WP_000343597.1 | hypothetical protein | - |
| NL708_RS15940 (3264705) | 3264705..3265253 | - | 549 | WP_001061574.1 | transcriptional regulator | - |
| NL708_RS15945 (3265416) | 3265416..3265766 | + | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL708_RS15950 (3265771) | 3265771..3266073 | + | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| NL708_RS15955 (3266100) | 3266100..3266393 | - | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
| NL708_RS15960 (3266481) | 3266481..3266753 | - | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
| NL708_RS15965 (3266811) | 3266811..3267338 | - | 528 | WP_001236377.1 | thermonuclease family protein | - |
| NL708_RS15970 (3267569) | 3267569..3268426 | - | 858 | WP_001167032.1 | hypothetical protein | - |
| NL708_RS15975 (3268413) | 3268413..3268643 | - | 231 | WP_000972663.1 | hypothetical protein | - |
| NL708_RS15980 (3268643) | 3268643..3269161 | - | 519 | WP_000210756.1 | nitrite reductase | - |
| NL708_RS15985 (3269158) | 3269158..3269604 | - | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
| NL708_RS15990 (3269604) | 3269604..3269963 | - | 360 | WP_000422768.1 | hypothetical protein | - |
| NL708_RS15995 (3270020) | 3270020..3270448 | - | 429 | WP_000591074.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / dfrA23 / sul1 / blaDHA-1 / qnrB4 / lnu(F) / aadA2 | entA / entB / entE / entC / fepB / entS / fepD / fepG / fepC / entF / fes / fepA | 3162988..3315216 | 152228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T250976 WP_000270043.1 NZ_CP100678:3265416-3265766 [Salmonella enterica subsp. enterica serovar Anatum]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11006.73 Da Isoelectric Point: 7.2036
>AT250976 WP_000124640.1 NZ_CP100678:3265771-3266073 [Salmonella enterica subsp. enterica serovar Anatum]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|